Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBPL2 Peptide - N-terminal region

TBPL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TBP2, TRF3

UniProt

Q6SJ96

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBPL2 Rabbit Polyclonal Antibody (orb586397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW80675

Preservative

Lyophilized powder

AA Sequence

SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), Biotin conjugate, 0.1mg/mL
BNCB2063-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Banf1 activation kit by CRISPRa
GA204767 1 Kit

Mouse Banf1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cell Navigator® Fluorimetric Lipid Droplet Assay Kit *Blue Fluorescence*
22731-AAT 200 Tests

Cell Navigator® Fluorimetric Lipid Droplet Assay Kit *Blue Fluorescence*

Sign In for Pricing
View Details
NFAT1 (NFATC2) Rabbit Monoclonal Antibody
TA423018 100 µL

NFAT1 (NFATC2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
3,4-Dihydroxybenzaldehyde
TRC-D451000-5G 5 g

3,4-Dihydroxybenzaldehyde

Sign In for Pricing
View Details
HCM (RNMT) (NM_003799) Human Recombinant Protein
TP307787L 1 mg

HCM (RNMT) (NM_003799) Human Recombinant Protein

Sign In for Pricing
View Details