Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP3 Peptide - N-terminal region

TNIP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABIN-3, FLJ21162, LIND

UniProt

Q96KP6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNIP3 Rabbit Polyclonal Antibody (orb586398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAB15018

Preservative

Lyophilized powder

AA Sequence

YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homarus americanus (California lobster) Gel – HMA- Immobilized Lectin
AK-6201-1 1 mL/Kit

Homarus americanus (California lobster) Gel – HMA- Immobilized Lectin

Sign In for Pricing
View Details
Rat Neuronal Pentraxin II (NPTX2) ELISA Kit
RDR-NPTX2-Ra-01 96 Tests

Rat Neuronal Pentraxin II (NPTX2) ELISA Kit

Sign In for Pricing
View Details
Rat Neuronal Pentraxin II (NPTX2) ELISA Kit
RDR-NPTX2-Ra-02 48 Tests

Rat Neuronal Pentraxin II (NPTX2) ELISA Kit

Sign In for Pricing
View Details
2-Hydroxyphenylboronic acid
TRC-H952913-500MG 500 mg

2-Hydroxyphenylboronic acid

Sign In for Pricing
View Details
Human TTC36 activation kit by CRISPRa
GA115476 1 Kit

Human TTC36 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DCAF4L2 activation kit by CRISPRa
GA115296 1 Kit

Human DCAF4L2 activation kit by CRISPRa

Sign In for Pricing
View Details