Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP3 Peptide - N-terminal region

TNIP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABIN-3, FLJ21162, LIND

UniProt

Q96KP6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNIP3 Rabbit Polyclonal Antibody (orb586398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAB15018

Preservative

Lyophilized powder

AA Sequence

YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: right
CB501329 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
CSB (ERCC6) Human Gene Knockout Kit (CRISPR)
KN219020 1 Kit

CSB (ERCC6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
XFD532 NHS Ester
1819-AAT 1 mg

XFD532 NHS Ester

Sign In for Pricing
View Details
TentaGel® MB PHB
MB250130.1G 1 g

TentaGel® MB PHB

Sign In for Pricing
View Details
4-Fluoroanisole
TRC-F587680-1G 1 g

4-Fluoroanisole

Sign In for Pricing
View Details
DUT (NM_001025249) Human Over-expression Lysate
LY422498 100 µg

DUT (NM_001025249) Human Over-expression Lysate

Sign In for Pricing
View Details