Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRC2 Peptide - C-terminal region

UQCRC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

QCR2, UQCR2

UniProt

P22695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UQCRC2 Rabbit Polyclonal Antibody (orb586401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003357

Preservative

Lyophilized powder

AA Sequence

GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-trans,12-cis-Linoleic Acid
TRC-L462520-50MG 50 mg

10-trans,12-cis-Linoleic Acid

Sign In for Pricing
View Details
4H-1,2,4-Triazol-3-amine
TRC-T802320-10MG 10 mg

4H-1,2,4-Triazol-3-amine

Sign In for Pricing
View Details
4-(4-Acetyl-3-hydroxy-2-propylphenoxy)butanoic Acid Ethyl Ester
TRC-A179140-500MG 500 mg

4-(4-Acetyl-3-hydroxy-2-propylphenoxy)butanoic Acid Ethyl Ester

Sign In for Pricing
View Details
5α-Pregnan-3β, 20α diol 3-sulfate-d5 Sodium Salt
TRC-P627711-10MG 10 mg

5α-Pregnan-3β, 20α diol 3-sulfate-d5 Sodium Salt

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
BNC402759-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSK (NM_001127190) Human Recombinant Protein
TP325740L 1 mg

CSK (NM_001127190) Human Recombinant Protein

Sign In for Pricing
View Details