RGD1308134 Peptide - N-terminal region
RGD1308134 Peptide - N-terminal region
Product Specifications
UniProt
B0BNM4
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGD1308134 Rabbit Polyclonal Antibody (orb325849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001120993
Preservative
Lyophilized powder
AA Sequence
VKRFGDDLNHISCVIKERTVAQIKTTVKRKVYEDSGIPLPAESPKKGPKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941081-100 1x 100 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details