Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBIP Peptide - C-terminal region

MBIP Peptide - C-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBIP Rabbit Polyclonal Antibody (orb584640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057670

Preservative

Lyophilized powder

AA Sequence

FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IER3
MBS7616950-01 0.05 mg

Recombinant Mouse IER3

Sign In for Pricing
View Details
Recombinant Mouse IER3
MBS7616950-02 0.2 mg

Recombinant Mouse IER3

Sign In for Pricing
View Details
Recombinant Mouse IER3
MBS7616950-03 1 mg

Recombinant Mouse IER3

Sign In for Pricing
View Details
Recombinant Mouse IER3
MBS7616950-04 5x 1 mg

Recombinant Mouse IER3

Sign In for Pricing
View Details
[3- (Dimethylamino) propyl][ (3-ethoxy-4-propoxyphenyl) methyl]amine dihydrochloride
ZRB75749-01 100 mg

[3- (Dimethylamino) propyl][ (3-ethoxy-4-propoxyphenyl) methyl]amine dihydrochloride

Sign In for Pricing
View Details
[3- (Dimethylamino) propyl][ (3-ethoxy-4-propoxyphenyl) methyl]amine dihydrochloride
ZRB75749-02 1 g

[3- (Dimethylamino) propyl][ (3-ethoxy-4-propoxyphenyl) methyl]amine dihydrochloride

Sign In for Pricing
View Details