Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBIP Peptide - C-terminal region

MBIP Peptide - C-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBIP Rabbit Polyclonal Antibody (orb584640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057670

Preservative

Lyophilized powder

AA Sequence

FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Adropin Antibody
NBP1-26387SS 0.025 mL

Rabbit Polyclonal Adropin Antibody

Sign In for Pricing
View Details
4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone
BUP00290-01 1 mg

4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone

Sign In for Pricing
View Details
4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone
BUP00290-02 2 mg

4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone

Sign In for Pricing
View Details
4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone
BUP00290-03 5 mg

4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone

Sign In for Pricing
View Details
4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone
BUP00290-04 10 mg

4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone

Sign In for Pricing
View Details
4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone
BUP00290-05 25 mg

4,12-Dimethoxy-6- (7,8-dihydroxy-7,8-dihydrostyryl) -2-pyrone

Sign In for Pricing
View Details