Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBIP Peptide - N-terminal region

MBIP Peptide - N-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBIP Rabbit Polyclonal Antibody (orb584641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057670

Preservative

Lyophilized powder

AA Sequence

EVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 (ROR2/1912), 1mg/mL
BNUM1912-50 1x 50 µL

ROR2 (ROR2/1912), 1mg/mL

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA601512 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
IRX2 Polyclonal Antibody
E-AB-18130-01 20 µL

IRX2 Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Polyclonal Antibody
E-AB-18130-02 60 µL

IRX2 Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Polyclonal Antibody
E-AB-18130-03 120 µL

IRX2 Polyclonal Antibody

Sign In for Pricing
View Details
IRX2 Polyclonal Antibody
E-AB-18130-04 200 µL

IRX2 Polyclonal Antibody

Sign In for Pricing
View Details