Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBIP Peptide - N-terminal region

MBIP Peptide - N-terminal region

Product Specifications

UniProt

Q9NS73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBIP Rabbit Polyclonal Antibody (orb584641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057670

Preservative

Lyophilized powder

AA Sequence

EVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta III Tubulin Recombinant Rabbit monoclonal Antibody
HA751554 100 µL

Beta III Tubulin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SIGIRR (NM_021805) Human Over-expression Lysate
LC402876 20 µg

SIGIRR (NM_021805) Human Over-expression Lysate

Sign In for Pricing
View Details
ARMC8 Rabbit Polyclonal Antibody
TA365817 100 µL

ARMC8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cep295 Mouse Gene Knockout Kit (CRISPR)
KN500479 1 Kit

Cep295 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bis(2-ethylhexyl) Azelate
TRC-B433820-1G 1 g

Bis(2-ethylhexyl) Azelate

Sign In for Pricing
View Details
Arachidonoyl-L-carnitine-d3 (may contain up to 1% of d0)
TRC-A765159-50MG 50 mg

Arachidonoyl-L-carnitine-d3 (may contain up to 1% of d0)

Sign In for Pricing
View Details