Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR37 Peptide - C-terminal region

GPR37 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EDNRBL, PAELR, hET (B) R-LP

UniProt

O15354

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR37 Rabbit Polyclonal Antibody (orb585981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005293

Preservative

Lyophilized powder

AA Sequence

KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP2 Antibody
KC-3134-01 50 μL

RP2 Antibody

Sign In for Pricing
View Details
RP2 Antibody
KC-3134-02 100 µL

RP2 Antibody

Sign In for Pricing
View Details
RP2 Antibody
KC-3134-03 1 mL

RP2 Antibody

Sign In for Pricing
View Details
Briakinumab Biosimilar - APC Research Grade
ICH5188APC-50ug 50 µg

Briakinumab Biosimilar - APC Research Grade

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS505130 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) (NM_001127687) Human Over-expression Lysate
LC426849 20 µg

Adiponectin Receptor 1 (ADIPOR1) (NM_001127687) Human Over-expression Lysate

Sign In for Pricing
View Details