Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAV Peptide - C-terminal region

ITGAV Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD51, DKFZp686A08142, MSK8, VNRA

UniProt

E7EWZ6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGAV Rabbit Polyclonal Antibody (orb586005) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138471

Preservative

Lyophilized powder

AA Sequence

PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS18 Peptide - N-terminal region
orb2013545 100 µg

ADAMTS18 Peptide - N-terminal region

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)
CSB-YP314621MLQ-01 10 µg

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)
CSB-YP314621MLQ-02 50 µg

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)
CSB-YP314621MLQ-03 200 µg

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)
CSB-YP314621MLQ-04 500 µg

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)
CSB-YP314621MLQ-05 100 µg

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46)

Sign In for Pricing
View Details