Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPBWR1 Peptide - N-terminal region

NPBWR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR7, MGC129755

UniProt

P48145

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPBWR1 Rabbit Polyclonal Antibody (orb586090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005276

Preservative

Lyophilized powder

AA Sequence

FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Anti-Factor Related Apoptosis (FAS)
FY-AB42507-01 1 mL

Biotin-Linked Anti-Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Biotin-Linked Anti-Factor Related Apoptosis (FAS)
FY-AB42507-02 100 µL

Biotin-Linked Anti-Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Biotin-Linked Anti-Factor Related Apoptosis (FAS)
FY-AB42507-03 200 µL

Biotin-Linked Anti-Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
CYP26A1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-54341R-PE-Cy7-TR 20 µL

CYP26A1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
TTYH1 (Protein Tweety Homolog 1, hTTY1) (AP)
MBS6134373-01 0.1 mL

TTYH1 (Protein Tweety Homolog 1, hTTY1) (AP)

Sign In for Pricing
View Details
TTYH1 (Protein Tweety Homolog 1, hTTY1) (AP)
MBS6134373-02 5x 0.1 mL

TTYH1 (Protein Tweety Homolog 1, hTTY1) (AP)

Sign In for Pricing
View Details