Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPC2 Peptide - C-terminal region

GPC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp547M109, FLJ38962

UniProt

Q8N158

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPC2 Rabbit Polyclonal Antibody (orb586258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689955

Preservative

Lyophilized powder

AA Sequence

GRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV675654 1.0 µg DNA

NUDT4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
3-Cyanovinylcarbazole phosphoramidite
MBS5816182 Inquire

3-Cyanovinylcarbazole phosphoramidite

Sign In for Pricing
View Details
5-Amino-3- (4-fluorophenyl) pyrazole
261084-01 2 g

5-Amino-3- (4-fluorophenyl) pyrazole

Sign In for Pricing
View Details
5-Amino-3- (4-fluorophenyl) pyrazole
261084-02 5 g

5-Amino-3- (4-fluorophenyl) pyrazole

Sign In for Pricing
View Details
5-Amino-3- (4-fluorophenyl) pyrazole
261084-03 10 g

5-Amino-3- (4-fluorophenyl) pyrazole

Sign In for Pricing
View Details
5-Amino-3- (4-fluorophenyl) pyrazole
261084-04 25 g

5-Amino-3- (4-fluorophenyl) pyrazole

Sign In for Pricing
View Details