Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPC2 Peptide - C-terminal region

GPC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp547M109, FLJ38962

UniProt

Q8N158

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPC2 Rabbit Polyclonal Antibody (orb586258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689955

Preservative

Lyophilized powder

AA Sequence

GRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Swine 4-Hydroxynonenal (4-HNE) ELISA Kit-Competitive
EK1F469 96 Tests

Swine 4-Hydroxynonenal (4-HNE) ELISA Kit-Competitive

Sign In for Pricing
View Details
Human KRTAP2-1 Pre-designed siRNA Set A
SI008450A 1 Each

Human KRTAP2-1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TPMT Mouse Monoclonal Antibody [Clone ID: OTI4C1]
TA501054S 30 µL

TPMT Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details
RNF10 Rabbit Polyclonal Antibody (FITC)
orb2135221 100 µL

RNF10 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MNAT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1313808 1.0 µg DNA

MNAT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Myadml2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4049607 1.0 µg DNA

Myadml2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details