Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YRDC Peptide - middle region

YRDC Peptide - middle region

Product Specifications

Product Name Alternative

DRIP3, FLJ23476, FLJ26165, IRIP, RP11-109P14.4, SUA5

UniProt

Q86U90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YRDC Rabbit Polyclonal Antibody (orb326548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078916

Preservative

Lyophilized powder

AA Sequence

VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine zonula occludens-1 (ZO-1) ELISA Kit
MBS9313754-01 48 Well

Canine zonula occludens-1 (ZO-1) ELISA Kit

Sign In for Pricing
View Details
Canine zonula occludens-1 (ZO-1) ELISA Kit
MBS9313754-02 96 Well

Canine zonula occludens-1 (ZO-1) ELISA Kit

Sign In for Pricing
View Details
Canine zonula occludens-1 (ZO-1) ELISA Kit
MBS9313754-03 5x 96 Well

Canine zonula occludens-1 (ZO-1) ELISA Kit

Sign In for Pricing
View Details
Canine zonula occludens-1 (ZO-1) ELISA Kit
MBS9313754-04 10x 96 Well

Canine zonula occludens-1 (ZO-1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Caldesmon/CALD1 Antibody (h-CALD) [DyLight 680]
NBP2-47816FR 0.1 mL

Mouse Monoclonal Caldesmon/CALD1 Antibody (h-CALD) [DyLight 680]

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 6 (IL6)
MBS2138380-01 0.1 mL

Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details