YRDC Peptide - middle region
YRDC Peptide - middle region
Product Specifications
Product Name Alternative
DRIP3, FLJ23476, FLJ26165, IRIP, RP11-109P14.4, SUA5
UniProt
Q86U90
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YRDC Rabbit Polyclonal Antibody (orb326548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078916
Preservative
Lyophilized powder
AA Sequence
VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15249159 1 Vial
Lentiviral mouse Cd4 shRNA (UAS) - Lentiviral mouse Cd4 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details MBS2011386-01 0.01 mg
Recombinant Epithelial Cell Transforming Sequence 2 (ECT2)
Sign In for Pricing
View Details MBS2011386-02 0.05 mg
Recombinant Epithelial Cell Transforming Sequence 2 (ECT2)
Sign In for Pricing
View Details MBS2011386-03 0.1 mg
Recombinant Epithelial Cell Transforming Sequence 2 (ECT2)
Sign In for Pricing
View Details MBS2011386-04 0.2 mg
Recombinant Epithelial Cell Transforming Sequence 2 (ECT2)
Sign In for Pricing
View Details MBS2011386-05 0.5 mg
Recombinant Epithelial Cell Transforming Sequence 2 (ECT2)
Sign In for Pricing
View Details