Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22RA2 Peptide - C-terminal region

IL22RA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRF2-10, CRF2-S1, CRF2X, IL-22BP, MGC150509, MGC150510

UniProt

Q969J5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL22RA2 Rabbit Polyclonal Antibody (orb586290) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443194

Preservative

Lyophilized powder

AA Sequence

NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor (7G3) Rabbit Monoclonal Antibody
E28M0849 100 µL

Glucocorticoid Receptor (7G3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PROM1 Rabbit Polyclonal Antibody (Fluoro594)
orb3112781 100 µg

PROM1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Anti-GSTP1 Antibody (1U351)
TMAH-00522-01 50 μL

Anti-GSTP1 Antibody (1U351)

Sign In for Pricing
View Details
Anti-GSTP1 Antibody (1U351)
TMAH-00522-02 100 µL

Anti-GSTP1 Antibody (1U351)

Sign In for Pricing
View Details
Anti-BMP6 (Rabbit, Monoclonal)
A109521 100 µL

Anti-BMP6 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Influenza A H5N1 (A/Vietnam/1194/2004) Hemagglutinin/HA Protein (RERRRKKR to TETR, HA1+HA2, uncleaved, His)
TMPY-01129-01 5 µg

Influenza A H5N1 (A/Vietnam/1194/2004) Hemagglutinin/HA Protein (RERRRKKR to TETR, HA1+HA2, uncleaved, His)

Sign In for Pricing
View Details