TIMM23B Peptide - N-terminal region
TIMM23B Peptide - N-terminal region
Product Specifications
Product Name Alternative
RP11-592B15.7, MGC22767, TIMM23, bA592B15.7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TIMM23B Rabbit Polyclonal Antibody (orb326552) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
CAI16098
Preservative
Lyophilized powder
AA Sequence
PRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041757-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA725078B 100 µL
Human Angiogenin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
