Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23B Peptide - N-terminal region

TIMM23B Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP11-592B15.7, MGC22767, TIMM23, bA592B15.7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMM23B Rabbit Polyclonal Antibody (orb326552) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

CAI16098

Preservative

Lyophilized powder

AA Sequence

PRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB4 Mouse Monoclonal Antibody [Clone ID: OTI2H5]
CF809208 100 µg

MAGEB4 Mouse Monoclonal Antibody [Clone ID: OTI2H5]

Sign In for Pricing
View Details
CBX5 Antibody
KC-6066-01 50 μL

CBX5 Antibody

Sign In for Pricing
View Details
CBX5 Antibody
KC-6066-02 100 µL

CBX5 Antibody

Sign In for Pricing
View Details
CBX5 Antibody
KC-6066-03 1 mL

CBX5 Antibody

Sign In for Pricing
View Details
Human NCE2 (UBE2F) activation kit by CRISPRa
GA115405 1 Kit

Human NCE2 (UBE2F) activation kit by CRISPRa

Sign In for Pricing
View Details
Human KLHL31 activation kit by CRISPRa
GA118321 1 Kit

Human KLHL31 activation kit by CRISPRa

Sign In for Pricing
View Details