YY2 Peptide - C-terminal region
YY2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZNF631
UniProt
O15391
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YY2 Rabbit Polyclonal Antibody (orb586301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996806
Preservative
Lyophilized powder
AA Sequence
GGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472642-100 1x 100 µL
Prolactin (Pituitary Tumor Marker) (PRL/2642), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
P012-405M-125 1x 125 µL
CD45 Mouse Monoclonal Antibody (2D1), CF®405M Conjugate - Biotium Choice
Sign In for Pricing
View Details 
BNC401388-100 1x 100 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2939-500 1x 500 µL
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), 0.2mg/mL
Sign In for Pricing
View Details