Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY2 Peptide - C-terminal region

YY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF631

UniProt

O15391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YY2 Rabbit Polyclonal Antibody (orb586301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996806

Preservative

Lyophilized powder

AA Sequence

GGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLCN4 activation kit by CRISPRa
GA100845 1 Kit

Human CLCN4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF405S conjugate, 0.1mg/mL
BNC043338-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MMP-7 Recombinant Rabbit Monoclonal Antibody [PSH07-94] - BSA and Azide free (Detector)
HA722927 100 µL

Human MMP-7 Recombinant Rabbit Monoclonal Antibody [PSH07-94] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
PC1/3 (PCSK1) (652-754) Mouse Monoclonal Antibody [Clone ID: 3D2]
AM31061PU-N 50 µg

PC1/3 (PCSK1) (652-754) Mouse Monoclonal Antibody [Clone ID: 3D2]

Sign In for Pricing
View Details
Human FOXD3 activation kit by CRISPRa
GA108970 1 Kit

Human FOXD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Carbon(isothiocyanatidic)acid Ethyl Ester
TRC-C176650-1G 1 g

Carbon(isothiocyanatidic)acid Ethyl Ester

Sign In for Pricing
View Details