Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CC2D2A Peptide - N-terminal region

CC2D2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

JBTS9, KIAA1345, MKS6

UniProt

E7EP21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CC2D2A Rabbit Polyclonal Antibody (orb326553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065836

Preservative

Lyophilized powder

AA Sequence

EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CoREST (RCOR1) Rabbit Polyclonal Antibody
TA372266 100 µL

CoREST (RCOR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL
BNC401133-100 1x 100 µL

CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human FABP3 Protein (His Tag)
PDEH100670-01 20 µg

Recombinant Human FABP3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FABP3 Protein (His Tag)
PDEH100670-02 100 µg

Recombinant Human FABP3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FABP3 Protein (His Tag)
PDEH100670-03 500 µg

Recombinant Human FABP3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FABP3 Protein (His Tag)
PDEH100670-04 1 mg

Recombinant Human FABP3 Protein (His Tag)

Sign In for Pricing
View Details