Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP135 Peptide - N-terminal region

CEP135 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEP4, KIAA0635

UniProt

Q66GS9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP135 Rabbit Polyclonal Antibody (orb586304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079285

Preservative

Lyophilized powder

AA Sequence

REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgE discontinued
136648 1 mg

IgE discontinued

Sign In for Pricing
View Details
ZMYND19 sgRNA CRISPR Lentivector set (Human)
K2680301 3x 1.0 µg

ZMYND19 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ACTN3 polyclonal antibody
orb1721846-01 50 µL

ACTN3 polyclonal antibody

Sign In for Pricing
View Details
ACTN3 polyclonal antibody
orb1721846-02 100 µL

ACTN3 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SLC4A4 Antibody
NBP3-17023-25ul 25 µL

Rabbit Polyclonal SLC4A4 Antibody

Sign In for Pricing
View Details
Recombinant Human TCL1A Protein, N-His
orb2835680-01 20 µg

Recombinant Human TCL1A Protein, N-His

Sign In for Pricing
View Details