Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP135 Peptide - N-terminal region

CEP135 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEP4, KIAA0635

UniProt

Q66GS9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP135 Rabbit Polyclonal Antibody (orb586304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079285

Preservative

Lyophilized powder

AA Sequence

REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TXNRD1 Antibody Picoband®, APC Conjugate
A01778-3-APC 100 µg/Vial

Anti-TXNRD1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
HDAC3 Antibody
V9743-20UG 20 µg

HDAC3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Myozenin 1 Antibody
NBP1-85439 0.1 mL

Rabbit Polyclonal Myozenin 1 Antibody

Sign In for Pricing
View Details
THNSL1 Rabbit pAb
E45R22082N 50 ul

THNSL1 Rabbit pAb

Sign In for Pricing
View Details
HEK293 SPINK13 Overexpression Lysate (Native) - (Dry Ice)
NBP2-08502 0.1 mg

HEK293 SPINK13 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
SEZ6L Protein Vector (Mouse) (pPB-N-His)
PV228395 500 ng

SEZ6L Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details