Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2B2 Peptide - middle region

EIF2B2 Peptide - middle region

Product Specifications

Product Name Alternative

EIF-2Bbeta, EIF2B

UniProt

P49770

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2B2 Rabbit Polyclonal Antibody (orb586312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055054

Preservative

Lyophilized powder

AA Sequence

EGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody
abx377988-01 50 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody
abx377988-02 100 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha (GADD45A) Antibody

Sign In for Pricing
View Details
Recombinant Human COMM domain-containing protein 5 (COMMD5)
CSB-MP872415HU-01 20 µg

Recombinant Human COMM domain-containing protein 5 (COMMD5)

Sign In for Pricing
View Details
Recombinant Human COMM domain-containing protein 5 (COMMD5)
CSB-MP872415HU-02 100 µg

Recombinant Human COMM domain-containing protein 5 (COMMD5)

Sign In for Pricing
View Details
Recombinant Human COMM domain-containing protein 5 (COMMD5)
CSB-MP872415HU-03 1 mg

Recombinant Human COMM domain-containing protein 5 (COMMD5)

Sign In for Pricing
View Details
CD180 antibody (PE)
61R-1321 0.05 mg

CD180 antibody (PE)

Sign In for Pricing
View Details