Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2B2 Peptide - middle region

EIF2B2 Peptide - middle region

Product Specifications

Product Name Alternative

EIF-2Bbeta, EIF2B

UniProt

P49770

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2B2 Rabbit Polyclonal Antibody (orb586312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055054

Preservative

Lyophilized powder

AA Sequence

EGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKEAARKRKFHVIVAEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ICAM4/ CD242 Protein, His-SUMO, E.coli-50ug
QP8170-ec-50ug 50ug

Recombinant Mouse ICAM4/ CD242 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details
VPRBP (C-8) Alexa Fluor® 546
sc-376850 AF546 200 µg/mL

VPRBP (C-8) Alexa Fluor® 546

Sign In for Pricing
View Details
PKM2 Antibody Picoband (monoclonal, 11I4C3)
orb1882167 100 µg

PKM2 Antibody Picoband (monoclonal, 11I4C3)

Sign In for Pricing
View Details
Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532
CSA3382-01 100 µL

Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532
CSA3382-02 500 μL

Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532
CSA3382-03 1 mL

Rabbit Anti-Hamster IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details