Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSA1 Peptide - C-terminal region

AHSA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AHA1, C14orf3, p38

UniProt

O95433

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AHSA1 Rabbit Polyclonal Antibody (orb586402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036243

Preservative

Lyophilized powder

AA Sequence

VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclomaltodextrin glucanotransferase Antibody, Biotin conjugated
A50673-100UG 100 µg

Cyclomaltodextrin glucanotransferase Antibody, Biotin conjugated

Sign In for Pricing
View Details
Native Human Complement Factor H Protein
CTP-458 250 µg

Native Human Complement Factor H Protein

Sign In for Pricing
View Details
Rabbit Polyclonal DPH5 Antibody [DyLight 488]
NBP2-97162G 0.1 mL

Rabbit Polyclonal DPH5 Antibody [DyLight 488]

Sign In for Pricing
View Details
3-(4-Fluorophenyl)thiophene
TRC-F596255-5MG 5 mg

3-(4-Fluorophenyl)thiophene

Sign In for Pricing
View Details
TLX3 (T-Cell Leukemia Homeobox 3, HOX11L2, MGC29804, RNX) (MaxLight 405) discontinued
252779-ML405 100 µL

TLX3 (T-Cell Leukemia Homeobox 3, HOX11L2, MGC29804, RNX) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Brca2 ORF Vector (Mouse) (pORF)
13454015 1.0 µg DNA

Brca2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details