Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSA1 Peptide - C-terminal region

AHSA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AHA1, C14orf3, p38

UniProt

O95433

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AHSA1 Rabbit Polyclonal Antibody (orb586402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036243

Preservative

Lyophilized powder

AA Sequence

VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM9 Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF800053 100 µg

TRIM9 Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
MBS1050621-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
MBS1050621-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
MBS1050621-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
MBS1050621-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
MBS1050621-05 1 mg (E-Coli)

Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B

Sign In for Pricing
View Details