Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKS1B Peptide - C-terminal region

ANKS1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIDA, AIDA-1, ANKS2, EB-1, EB1, MGC26087, cajalin-2

UniProt

Q7Z6G8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKS1B Rabbit Polyclonal Antibody (orb586405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_858056

Preservative

Lyophilized powder

AA Sequence

PSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnnm1 Mouse Gene Knockout Kit (CRISPR)
KN503553 1 Kit

Cnnm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human HOTS activation kit by CRISPRa
GA119611 1 Kit

Human HOTS activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF740 conjugate, 0.1mg/mL
BNC741692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYC (EQKLISEEDL) -tagged Protein Purification Kit
EA-TP-K003 1Test

MYC (EQKLISEEDL) -tagged Protein Purification Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS623883 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
FA-GLY-OH
TRC-F160090-50MG 50 mg

FA-GLY-OH

Sign In for Pricing
View Details