Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKS1B Peptide - C-terminal region

ANKS1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIDA, AIDA-1, ANKS2, EB-1, EB1, MGC26087, cajalin-2

UniProt

Q7Z6G8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKS1B Rabbit Polyclonal Antibody (orb586405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_858056

Preservative

Lyophilized powder

AA Sequence

PSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TyraMaxTM 490/520 Amplification Dye, 100X
#96137-100UL 1x 100 µL

TyraMaxTM 490/520 Amplification Dye, 100X

Sign In for Pricing
View Details
2’-Deoxycytidine-5-carboxylic Acid Sodium Salt (>85%)
TRC-D233045-25MG 25 mg

2’-Deoxycytidine-5-carboxylic Acid Sodium Salt (>85%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS639476 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
Human MBP (Myelin Basic Protein) ELISA Kit
E-EL-H0161-01 24 Tests

Human MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Human MBP (Myelin Basic Protein) ELISA Kit
E-EL-H0161-02 48 Tests

Human MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Human MBP (Myelin Basic Protein) ELISA Kit
E-EL-H0161-03 96 Tests

Human MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details