Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRDL2 Peptide - N-terminal region

CHRDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BNF1, CHL2, DKFZp586N2124, FKSG37

UniProt

Q6WN34

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRDL2 Rabbit Polyclonal Antibody (orb586407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056239

Preservative

Lyophilized powder

AA Sequence

CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lmo4 activation kit by CRISPRa
GA202474 1 Kit

Mouse Lmo4 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NDUFAF6 activation kit by CRISPRa
GA115283 1 Kit

Human NDUFAF6 activation kit by CRISPRa

Sign In for Pricing
View Details
LEFTY2 (NM_001172425) Human Over-expression Lysate
LY432898 100 µg

LEFTY2 (NM_001172425) Human Over-expression Lysate

Sign In for Pricing
View Details
CD59 Mouse Monoclonal Antibody [Clone ID: 1F5]
AM06017FC-N 100 µg

CD59 Mouse Monoclonal Antibody [Clone ID: 1F5]

Sign In for Pricing
View Details
Recombinant KDM1A Antibody
RC-15297-01 50 μL

Recombinant KDM1A Antibody

Sign In for Pricing
View Details
Recombinant KDM1A Antibody
RC-15297-02 100 µL

Recombinant KDM1A Antibody

Sign In for Pricing
View Details