Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRDL2 Peptide - N-terminal region

CHRDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BNF1, CHL2, DKFZp586N2124, FKSG37

UniProt

Q6WN34

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRDL2 Rabbit Polyclonal Antibody (orb586407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056239

Preservative

Lyophilized powder

AA Sequence

CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT6 (N-term) Rabbit Polyclonal Antibody
AP11013PU-N 400 µL

PRMT6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CD134/OX40L Recepter Antibody
RC-16440-01 50 μL

Recombinant CD134/OX40L Recepter Antibody

Sign In for Pricing
View Details
Recombinant CD134/OX40L Recepter Antibody
RC-16440-02 100 µL

Recombinant CD134/OX40L Recepter Antibody

Sign In for Pricing
View Details
Recombinant CD134/OX40L Recepter Antibody
RC-16440-03 1 mL

Recombinant CD134/OX40L Recepter Antibody

Sign In for Pricing
View Details
Dynein intermediate chain 1 (DNAI1) (NM_012144) Human Over-expression Lysate
LC402158 20 µg

Dynein intermediate chain 1 (DNAI1) (NM_012144) Human Over-expression Lysate

Sign In for Pricing
View Details
C4BPB (NM_001017365) Human Over-expression Lysate
LY422639 100 µg

C4BPB (NM_001017365) Human Over-expression Lysate

Sign In for Pricing
View Details