Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAIR1 Peptide - middle region

LAIR1 Peptide - middle region

Product Specifications

Product Name Alternative

CD305, LAIR-1

UniProt

Q6GTX8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAIR1 Rabbit Polyclonal Antibody (orb331334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068352

Preservative

Lyophilized powder

AA Sequence

GNAGPYRCIYYKPPKWSEQSDYLELLVKGPTQRPSDNSHNEHAPASQGLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD48 Monoclonal Antibody
AN301698L-01 50 µL

Recombinant CD48 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD48 Monoclonal Antibody
AN301698L-02 100 µL

Recombinant CD48 Monoclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8B5]
CF804212 100 µg

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8B5]

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®568 Conjugate - Biotium Choice
P009-568-125 1x 125 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), Biotin conjugate, 0.1mg/mL
BNCB1686-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,2'-Bipyridyl-d8
TRC-B399328-5MG 5 mg

2,2'-Bipyridyl-d8

Sign In for Pricing
View Details