Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAIR1 Peptide - middle region

LAIR1 Peptide - middle region

Product Specifications

Product Name Alternative

CD305, LAIR-1

UniProt

Q6GTX8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAIR1 Rabbit Polyclonal Antibody (orb331334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068352

Preservative

Lyophilized powder

AA Sequence

GNAGPYRCIYYKPPKWSEQSDYLELLVKGPTQRPSDNSHNEHAPASQGLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Oxopropyl)carbamic Acid tert-Butyl Ester
TRC-O990068-50MG 50 mg

(2-Oxopropyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
ZRANB2 antibody
FNab09755 100 µg

ZRANB2 antibody

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), CF405S conjugate, 0.1mg/mL
BNC043156-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(E)-3-[3-Ethoxy-4-(phthalimidyl)anilino]-N-(3-chloro-4-fluorophenyl)-2-cyano-2-propenamide
TRC-E892785-50MG 50 mg

(E)-3-[3-Ethoxy-4-(phthalimidyl)anilino]-N-(3-chloro-4-fluorophenyl)-2-cyano-2-propenamide

Sign In for Pricing
View Details
Human C8orf82 activation kit by CRISPRa
GA118416 1 Kit

Human C8orf82 activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn2r73 Mouse Gene Knockout Kit (CRISPR)
KN519204 1 Kit

Vmn2r73 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details