Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MREG Peptide - C-terminal region

MREG Peptide - C-terminal region

Product Specifications

Product Name Alternative

DSU, FLJ10116, MGC90296, WDT2

UniProt

Q8N565

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MREG Rabbit Polyclonal Antibody (orb326573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060470

Preservative

Lyophilized powder

AA Sequence

DSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Skin Aspartic Protease ELISA kit
GTR10456008 96 Well

Guinea Pig Skin Aspartic Protease ELISA kit

Sign In for Pricing
View Details
EPHX2 Rabbit Polyclonal Antibody (FITC)
orb2616756 100 µg

EPHX2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MdoB Antibody
orb818537 2 mg

MdoB Antibody

Sign In for Pricing
View Details
AQP4 Conjugated Antibody
orb1624403 100 µL

AQP4 Conjugated Antibody

Sign In for Pricing
View Details
TAFA5 antibody
FNab02977 100 µg

TAFA5 antibody

Sign In for Pricing
View Details
ATF2 Immunizing Peptide
MBS425508-01 0.1 mg

ATF2 Immunizing Peptide

Sign In for Pricing
View Details