Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT7 Peptide - N-terminal region

NUDT7 Peptide - N-terminal region

Product Specifications

UniProt

P0C024

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT7 Rabbit Polyclonal Antibody (orb586416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099133

Preservative

Lyophilized powder

AA Sequence

VRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Lebercilin (LCA5) ELISA Kit
MBS9354940 Inquire

Goat Lebercilin (LCA5) ELISA Kit

Sign In for Pricing
View Details
KbaY Antibody
orb819852 2 mg

KbaY Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Cholecystokinin Antibody [mFluor Violet 450 SE]
NBP3-18225MFV450 0.1 mL

Rabbit Polyclonal Cholecystokinin Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Apolipoprotein CIII Recombinant Rabbit mAb
BS48925 50 ul

Apolipoprotein CIII Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mouse IL-18BP (Interleukin 18 Binding Protein) ELISA Kit
EM24033 96 Tests

Mouse IL-18BP (Interleukin 18 Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Recombinant Neurospora crassa Enolase (NCU10042)
MBS1339124-01 0.02 mg (E-Coli)

Recombinant Neurospora crassa Enolase (NCU10042)

Sign In for Pricing
View Details