Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Q2 Peptide - middle region

UBE2Q2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp762C143

UniProt

Q8WVN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2Q2 Rabbit Polyclonal Antibody (orb586429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775740

Preservative

Lyophilized powder

AA Sequence

EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF4 Mouse Monoclonal Antibody [Clone ID: OTI2D8]
CF810090 100 µg

ELF4 Mouse Monoclonal Antibody [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Sncb Mouse Gene Knockout Kit (CRISPR)
KN516383 1 Kit

Sncb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Serotonin Beta-D-Glucuronide
TRC-S274990-5MG 5 mg

Serotonin Beta-D-Glucuronide

Sign In for Pricing
View Details
CTNND1 Rabbit Monoclonal Antibody [Clone ID: OTIR4F6]
TA592819S 30 µL

CTNND1 Rabbit Monoclonal Antibody [Clone ID: OTIR4F6]

Sign In for Pricing
View Details
Tissue Total RNA, Bone: tibia, proximal
CR559741 5 µg

Tissue Total RNA, Bone: tibia, proximal

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF568 conjugate, 0.1mg/mL
BNC681505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details