Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER2 Peptide - middle region

ACER2 Peptide - middle region

Product Specifications

Product Name Alternative

ASAH3L, FLJ41587

UniProt

Q5QJU3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACER2 Rabbit Polyclonal Antibody (orb586430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010887

Preservative

Lyophilized powder

AA Sequence

DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Pyrazin-2-yl-1,3-thiazole-4-carboxylic acid
sc-308640 500 mg

2-Pyrazin-2-yl-1,3-thiazole-4-carboxylic acid

Sign In for Pricing
View Details
[5- (4-Bromophenyl) furan-2-yl]methanamine hydrochloride
ZRB74111-01 50 mg

[5- (4-Bromophenyl) furan-2-yl]methanamine hydrochloride

Sign In for Pricing
View Details
[5- (4-Bromophenyl) furan-2-yl]methanamine hydrochloride
ZRB74111-02 0.5 g

[5- (4-Bromophenyl) furan-2-yl]methanamine hydrochloride

Sign In for Pricing
View Details
MAb to Adenovirus Hexon
MBS313322-01 1 mg

MAb to Adenovirus Hexon

Sign In for Pricing
View Details
MAb to Adenovirus Hexon
MBS313322-02 5x 1 mg

MAb to Adenovirus Hexon

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 ELISA Kit
MBS052536-01 48 Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 ELISA Kit

Sign In for Pricing
View Details