Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER2 Peptide - middle region

ACER2 Peptide - middle region

Product Specifications

Product Name Alternative

ASAH3L, FLJ41587

UniProt

Q5QJU3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACER2 Rabbit Polyclonal Antibody (orb586430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010887

Preservative

Lyophilized powder

AA Sequence

DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0146 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1132905 3x 1.0 µg

KIAA0146 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IgM (HRP)
I1905-15Q 1 mg

IgM (HRP)

Sign In for Pricing
View Details
NEURL CRISPR All-in-one AAV vector set (with saCas9)(Human)
31733151 3x 1.0 µg DNA

NEURL CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit Apolipoprotein B-100, APOB ELISA KIT
E0150Rb-01 48 Well

Rabbit Apolipoprotein B-100, APOB ELISA KIT

Sign In for Pricing
View Details
Rabbit Apolipoprotein B-100, APOB ELISA KIT
E0150Rb-02 96 Well

Rabbit Apolipoprotein B-100, APOB ELISA KIT

Sign In for Pricing
View Details
Rabbit Apolipoprotein B-100, APOB ELISA KIT
E0150Rb-03 5x 96 Tests

Rabbit Apolipoprotein B-100, APOB ELISA KIT

Sign In for Pricing
View Details