Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND5 Peptide - N-terminal region

BEND5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf165, FLJ11588

UniProt

Q7L4P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEND5 Rabbit Polyclonal Antibody (orb586431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078879

Preservative

Lyophilized powder

AA Sequence

EDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561810 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
CD19 Mouse Monoclonal Antibody [Clone ID: 2E2B6B10]
AM06097PU-N 100 µL

CD19 Mouse Monoclonal Antibody [Clone ID: 2E2B6B10]

Sign In for Pricing
View Details
1-Phenyl-2-(p-tolyl)ethylamine
TRC-P337085-250MG 250 mg

1-Phenyl-2-(p-tolyl)ethylamine

Sign In for Pricing
View Details
Recombinant Mouse ADIPOQ Protein (His Tag)
PDEM100236-01 20 µg

Recombinant Mouse ADIPOQ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ADIPOQ Protein (His Tag)
PDEM100236-02 100 µg

Recombinant Mouse ADIPOQ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ADIPOQ Protein (His Tag)
PDEM100236-03 500 µg

Recombinant Mouse ADIPOQ Protein (His Tag)

Sign In for Pricing
View Details