Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND5 Peptide - N-terminal region

BEND5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf165, FLJ11588

UniProt

Q7L4P6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEND5 Rabbit Polyclonal Antibody (orb586431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078879

Preservative

Lyophilized powder

AA Sequence

EDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS506213 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
MYO6 Antibody
KC-1383-01 50 μL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1383-02 100 µL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1383-03 1 mL

MYO6 Antibody

Sign In for Pricing
View Details
Follistatin (FST) Human qPCR Primer Pair (NM_013409)
HP232105 200 Reactions

Follistatin (FST) Human qPCR Primer Pair (NM_013409)

Sign In for Pricing
View Details
Purified Anti-Mouse Ly6C Antibody
RD21497F-01 25 µg

Purified Anti-Mouse Ly6C Antibody

Sign In for Pricing
View Details