Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMP1 Peptide - C-terminal region

CEMP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CP-23, CP23

UniProt

Q6PRD7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEMP1 Rabbit Polyclonal Antibody (orb586433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041677

Preservative

Lyophilized powder

AA Sequence

RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtnr1b siRNA Oligos set (Mouse)
31082174 3x 5 nmol

Mtnr1b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Crispld1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3686003 1.0 µg DNA

Crispld1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cdc42ep3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6528903 1.0 µg DNA

Cdc42ep3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
IL9 Antibody
OACD04777-100UL 100 µL

IL9 Antibody

Sign In for Pricing
View Details
SERPINB10 Protein Vector (Rat) (pPM-C-HA)
43465026 500 ng

SERPINB10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Heparanase (HPSE)
MBS2148593-01 0.1 mL

PE-Linked Monoclonal Antibody to Heparanase (HPSE)

Sign In for Pricing
View Details