Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMP1 Peptide - C-terminal region

CEMP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CP-23, CP23

UniProt

Q6PRD7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEMP1 Rabbit Polyclonal Antibody (orb586433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041677

Preservative

Lyophilized powder

AA Sequence

RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1-Phenyl-1H-benzo[d]imidazol-5-yl) boronic acid
OR1062253-01 100 mg

(1-Phenyl-1H-benzo[d]imidazol-5-yl) boronic acid

Sign In for Pricing
View Details
(1-Phenyl-1H-benzo[d]imidazol-5-yl) boronic acid
OR1062253-02 250 mg

(1-Phenyl-1H-benzo[d]imidazol-5-yl) boronic acid

Sign In for Pricing
View Details
Mouse mmu-miR-7090-3p miRNA Agomir
abx884241-01 5 nmol

Mouse mmu-miR-7090-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7090-3p miRNA Agomir
abx884241-02 10 nmol

Mouse mmu-miR-7090-3p miRNA Agomir

Sign In for Pricing
View Details
Rabbit Polyclonal ABCB5 Antibody
NBP1-77687 0.1 mL

Rabbit Polyclonal ABCB5 Antibody

Sign In for Pricing
View Details
SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2)
S5455-03B 200 µL

SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2)

Sign In for Pricing
View Details