Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHKBP1 Peptide - N-terminal region

SHKBP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PP203, Sb1

UniProt

Q8TBC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHKBP1 Rabbit Polyclonal Antibody (orb575476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612401

Preservative

Lyophilized powder

AA Sequence

TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42 (NM_001039802) Human Recombinant Protein
TP319153 20 µg

CDC42 (NM_001039802) Human Recombinant Protein

Sign In for Pricing
View Details
PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF809758 100 µg

PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Recombinant PUM1 Antibody
RC-15898-01 50 μL

Recombinant PUM1 Antibody

Sign In for Pricing
View Details
Recombinant PUM1 Antibody
RC-15898-02 100 µL

Recombinant PUM1 Antibody

Sign In for Pricing
View Details
Recombinant PUM1 Antibody
RC-15898-03 1 mL

Recombinant PUM1 Antibody

Sign In for Pricing
View Details
IL18BP Human
OM296446-01 20 µg

IL18BP Human

Sign In for Pricing
View Details