Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHKBP1 Peptide - N-terminal region

SHKBP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PP203, Sb1

UniProt

Q8TBC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHKBP1 Rabbit Polyclonal Antibody (orb575476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612401

Preservative

Lyophilized powder

AA Sequence

TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOSLG Antibody
KC-7953-01 50 μL

ICOSLG Antibody

Sign In for Pricing
View Details
ICOSLG Antibody
KC-7953-02 100 µL

ICOSLG Antibody

Sign In for Pricing
View Details
ICOSLG Antibody
KC-7953-03 1 mL

ICOSLG Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A2 Antibody
8C12250-AAT 50 µg

Cytochrome P450 1A2 Antibody

Sign In for Pricing
View Details
HRP Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-
H-3101-1 1 mg

HRP Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-

Sign In for Pricing
View Details
Nivolumab Biosimilar - Research Grade
ICH4009-10mg 10 mg (2x 5 mg)

Nivolumab Biosimilar - Research Grade

Sign In for Pricing
View Details