Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stc1 Peptide - C-terminal region

Stc1 Peptide - C-terminal region

Product Specifications

UniProt

P97574

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stc1 Rabbit Polyclonal Antibody (orb578338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112385

Preservative

Lyophilized powder

AA Sequence

EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA2, aa1-270, Recombinant, Human (Replication Protein A2, 32kD)
R3401 50 µg

RPA2, aa1-270, Recombinant, Human (Replication Protein A2, 32kD)

Sign In for Pricing
View Details
B-HT 933 dihydrochloride
2758/50 50 mg

B-HT 933 dihydrochloride

Sign In for Pricing
View Details
UNC 0646
A4504-50 50 mg

UNC 0646

Sign In for Pricing
View Details
ACYP1 Antibody
OACD01179-100UL 100 µL

ACYP1 Antibody

Sign In for Pricing
View Details
MHC Class I (RT1Ac) Mouse Monoclonal Antibody [Clone ID: OX-27]
CL129F 100 µg

MHC Class I (RT1Ac) Mouse Monoclonal Antibody [Clone ID: OX-27]

Sign In for Pricing
View Details
Anapc2 ORF Vector (Rat) (pORF)
ORF063375 1.0 µg DNA

Anapc2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details