Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stc1 Peptide - C-terminal region

Stc1 Peptide - C-terminal region

Product Specifications

UniProt

P97574

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stc1 Rabbit Polyclonal Antibody (orb578338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112385

Preservative

Lyophilized powder

AA Sequence

EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (AP) discontinued
127569-AP 100 µL

Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (AP) discontinued

Sign In for Pricing
View Details
Vmn2r11 (NM_001104622) Mouse Tagged Lenti ORF Clone
MR214605L4 10 µg

Vmn2r11 (NM_001104622) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ETV2 Rabbit Polyclonal Antibody (PE-Cy7)
orb921561 100 µL

ETV2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
GTF2IRD2 (NM_173537) Human Over-expression Lysate
LY406336 100 µg

GTF2IRD2 (NM_173537) Human Over-expression Lysate

Sign In for Pricing
View Details
Mpp6 (NM_001164733) Mouse Untagged Clone
MC218830 10 µg

Mpp6 (NM_001164733) Mouse Untagged Clone

Sign In for Pricing
View Details
LOXL3 Human Over-expression Lysate
orb1351726 100 µg

LOXL3 Human Over-expression Lysate

Sign In for Pricing
View Details