Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcb8 Peptide - middle region

Abcb8 Peptide - middle region

Product Specifications

Product Name Alternative

4833412N02Rik, AA409895

UniProt

Q9CXJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcb8 Rabbit Polyclonal Antibody (orb330330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083296

Preservative

Lyophilized powder

AA Sequence

ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-01 0.05 mg (E-Coli)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-02 0.05 mg (Yeast)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-03 0.2 mg (E-Coli)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-04 0.05 mg (Baculovirus)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-05 0.5 mg (E-Coli)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
MBS1289763-06 0.2 mg (Yeast)

Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)

Sign In for Pricing
View Details