Abcb8 Peptide - middle region
Abcb8 Peptide - middle region
Product Specifications
Product Name Alternative
4833412N02Rik, AA409895
UniProt
Q9CXJ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Abcb8 Rabbit Polyclonal Antibody (orb330330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_083296
Preservative
Lyophilized powder
AA Sequence
ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1289763-01 0.05 mg (E-Coli)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details MBS1289763-02 0.05 mg (Yeast)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details MBS1289763-03 0.2 mg (E-Coli)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details MBS1289763-04 0.05 mg (Baculovirus)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details MBS1289763-05 0.5 mg (E-Coli)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details MBS1289763-06 0.2 mg (Yeast)
Recombinant Ashbya gossypii Pre-mRNA-splicing factor SLU7 (SLU7)
Sign In for Pricing
View Details