Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcb8 Peptide - middle region

Abcb8 Peptide - middle region

Product Specifications

Product Name Alternative

4833412N02Rik, AA409895

UniProt

Q9CXJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcb8 Rabbit Polyclonal Antibody (orb330330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083296

Preservative

Lyophilized powder

AA Sequence

ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA10D Protein Vector (Human) (pPM-C-His)
PV078896 500 ng

FRA10D Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Monkey Brain Cerebral Cortex Frozen Sections, Cynomolgus
KF-210 10 Slides

Monkey Brain Cerebral Cortex Frozen Sections, Cynomolgus

Sign In for Pricing
View Details
Human LAG3 (Lymphocyte Activation Gene 3) ELISA Kit
EH25467 96 Tests

Human LAG3 (Lymphocyte Activation Gene 3) ELISA Kit

Sign In for Pricing
View Details
APOL2 Antibody
CSB-PA000907-01 50 µg

APOL2 Antibody

Sign In for Pricing
View Details
APOL2 Antibody
CSB-PA000907-02 100 µg

APOL2 Antibody

Sign In for Pricing
View Details
Rno-miR-26b-3p miRNA Agomir
CMS0251-01 5 nmol

Rno-miR-26b-3p miRNA Agomir

Sign In for Pricing
View Details