Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smpd4 Peptide - middle region

Smpd4 Peptide - middle region

Product Specifications

Product Name Alternative

RGD1310674

UniProt

F1MAK9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smpd4 Rabbit Polyclonal Antibody (orb580034) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001161278

Preservative

Lyophilized powder

AA Sequence

LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPGRIP1 Protein Vector (Mouse) (pPB-N-His)
PV225247 500 ng

RPGRIP1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
AZGP1 (Zinc-alpha-2-glycoprotein, Zn-alpha-2-GP, Zn-alpha-2-glycoprotein, ZAG, ZNGP1) (Biotin)
MBS6370817-01 0.1 mL

AZGP1 (Zinc-alpha-2-glycoprotein, Zn-alpha-2-GP, Zn-alpha-2-glycoprotein, ZAG, ZNGP1) (Biotin)

Sign In for Pricing
View Details
AZGP1 (Zinc-alpha-2-glycoprotein, Zn-alpha-2-GP, Zn-alpha-2-glycoprotein, ZAG, ZNGP1) (Biotin)
MBS6370817-02 5x 0.1 mL

AZGP1 (Zinc-alpha-2-glycoprotein, Zn-alpha-2-GP, Zn-alpha-2-glycoprotein, ZAG, ZNGP1) (Biotin)

Sign In for Pricing
View Details
GG8L2, NT (Golgin subfamily A member 8-like protein 2, ) (MaxLight 405) discontinued
036013-ML405 100 µL

GG8L2, NT (Golgin subfamily A member 8-like protein 2, ) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EPAS1 Antibody
MBS7117553-01 0.05 mg

EPAS1 Antibody

Sign In for Pricing
View Details
EPAS1 Antibody
MBS7117553-02 0.1 mg

EPAS1 Antibody

Sign In for Pricing
View Details